PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013620052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 424aa    MW: 48262.2 Da    PI: 9.4273
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013620052.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-17105151148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd +l+++v+qlG + W+ I++++  gR +kqc++rw+++l
   XP_013620052.1 105 KGQWTAEEDRKLIRLVRQLGERKWAMISQKLE-GRAGKQCRERWHNHL 151
                      799*****************************.*************97 PP

2Myb_DNA-binding53.36.3e-17158199245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + W++eE+  lv+a+k+ G++ W+ Ia+ ++ gRt++++k++w+
   XP_013620052.1 158 DGWSEEEERVLVEAHKRIGNK-WAEIAKLIP-GRTENSIKNHWN 199
                      56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.568100155IPR017930Myb domain
SuperFamilySSF466892.05E-29102198IPR009057Homeodomain-like
SMARTSM007172.7E-15104153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-26106159IPR009057Homeodomain-like
CDDcd001674.59E-14108151No hitNo description
PfamPF139215.3E-18108166No hitNo description
SMARTSM007176.4E-15156204IPR001005SANT/Myb domain
PROSITE profilePS5129418.969156206IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-20160204IPR009057Homeodomain-like
CDDcd001671.76E-11160202No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MEHRRLVHGA APPLTAVERF LYGQKNDTLC PKKQDCSRDR HPPIMKKTKA IETKNDNKEN  60
HTCGPRKDKY LVANGRISIG DMVVKDATRD YQNPTKKRPC KNIIKGQWTA EEDRKLIRLV  120
RQLGERKWAM ISQKLEGRAG KQCRERWHNH LRPDIKKDGW SEEEERVLVE AHKRIGNKWA  180
EIAKLIPGRT ENSIKNHWNA TKRRQNSKRK QKRRQENADN YDSDLPPAAK RPCILQDYIK  240
SVYNNVENKA SDDNKNEISI SVLSTPNLDQ TYSDGDSTSS VLGDPYDEEL VYLQNIFANH  300
PVSLDNIGLN QTSDEVNMIK NPSSHKSVWT HHQDQAMVAV PENKPHLASD IYLSYLLNGT  360
ASSSYSNPHF PSSSSSTSST TVEKGGYSEF LVPHANSTGE KREMDLMEML SGSIQGGNKC  420
FPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-451032052104C-Myb DNA-Binding Domain
1msf_C8e-451032052104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201212KRRQNSKRKQKR
2207214KRKQKRRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013620052.10.0PREDICTED: transcription factor MYB48
TrEMBLA0A0D3AL550.0A0A0D3AL55_BRAOL; Uncharacterized protein
STRINGBra020346.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.10.0myb domain protein 119